Lineage for d2btyc1 (2bty C:1-282)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 843596Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 843597Superfamily c.73.1: Carbamate kinase-like [53633] (3 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 843608Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (1 protein)
  6. 843609Protein N-acetyl-l-glutamate kinase [75298] (4 species)
  7. 843636Species Thermotoga maritima [TaxId:2336] [142720] (1 PDB entry)
    Uniprot Q9X2A4 1-282
  8. 843639Domain d2btyc1: 2bty C:1-282 [129163]
    automatically matched to 2BTY A:1-282
    complexed with arg, k, nlg

Details for d2btyc1

PDB Entry: 2bty (more details), 2.75 Å

PDB Description: acetylglutamate kinase from thermotoga maritima complexed with its inhibitor arginine
PDB Compounds: (C:) acetylglutamate kinase

SCOP Domain Sequences for d2btyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2btyc1 c.73.1.2 (C:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]}
mridtvnvllealpyikefygktfvikfggsamkqenakkafiqdiillkytgikpiivh
gggpaisqmmkdlgiepvfknghrvtdektmeivemvlvgkinkeivmnlnlhggravgi
cgkdsklivaeketkhgdigyvgkvkkvnpeilhaliendyipviapvgigedghsynin
adtaaaeiakslmaeklilltdvdgvlkdgklistltpdeaeelirdgtvtggmipkvec
avsavrggvgavhiingglehailleifsrkgigtmikeleg

SCOP Domain Coordinates for d2btyc1:

Click to download the PDB-style file with coordinates for d2btyc1.
(The format of our PDB-style files is described here.)

Timeline for d2btyc1: