![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
![]() | Superfamily c.73.1: Carbamate kinase-like [53633] (3 families) ![]() the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
![]() | Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (1 protein) |
![]() | Protein N-acetyl-l-glutamate kinase [75298] (4 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [142720] (1 PDB entry) |
![]() | Domain d2btyc1: 2bty C:1-282 [129163] automatically matched to 2BTY A:1-282 complexed with arg, k, nlg |
PDB Entry: 2bty (more details), 2.75 Å
SCOP Domain Sequences for d2btyc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2btyc1 c.73.1.2 (C:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]} mridtvnvllealpyikefygktfvikfggsamkqenakkafiqdiillkytgikpiivh gggpaisqmmkdlgiepvfknghrvtdektmeivemvlvgkinkeivmnlnlhggravgi cgkdsklivaeketkhgdigyvgkvkkvnpeilhaliendyipviapvgigedghsynin adtaaaeiakslmaeklilltdvdgvlkdgklistltpdeaeelirdgtvtggmipkvec avsavrggvgavhiingglehailleifsrkgigtmikeleg
Timeline for d2btyc1: