Lineage for d2btyc_ (2bty C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905147Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins)
  6. 2905181Protein automated matches [190527] (4 species)
    not a true protein
  7. 2905199Species Thermotoga maritima [TaxId:2336] [187487] (1 PDB entry)
  8. 2905201Domain d2btyc_: 2bty C: [129163]
    Other proteins in same PDB: d2btya1
    automated match to d2btya1
    complexed with arg, k, nlg

Details for d2btyc_

PDB Entry: 2bty (more details), 2.75 Å

PDB Description: acetylglutamate kinase from thermotoga maritima complexed with its inhibitor arginine
PDB Compounds: (C:) acetylglutamate kinase

SCOPe Domain Sequences for d2btyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2btyc_ c.73.1.2 (C:) automated matches {Thermotoga maritima [TaxId: 2336]}
mridtvnvllealpyikefygktfvikfggsamkqenakkafiqdiillkytgikpiivh
gggpaisqmmkdlgiepvfknghrvtdektmeivemvlvgkinkeivmnlnlhggravgi
cgkdsklivaeketkhgdigyvgkvkkvnpeilhaliendyipviapvgigedghsynin
adtaaaeiakslmaeklilltdvdgvlkdgklistltpdeaeelirdgtvtggmipkvec
avsavrggvgavhiingglehailleifsrkgigtmikeleg

SCOPe Domain Coordinates for d2btyc_:

Click to download the PDB-style file with coordinates for d2btyc_.
(The format of our PDB-style files is described here.)

Timeline for d2btyc_: