SCOPe 2.05: Domain d2btya1: 2bty A:1-282

Lineage for d2btya1 (2bty A:1-282)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins)

6. Protein N-acetyl-l-glutamate kinase [75298] (4 species)

7. Species Thermotoga maritima [TaxId:2336] [142720] (1 PDB entry)
   Uniprot Q9X2A4 1-282

8. Domain d2btya1: 2bty A:1-282 [129161]
   Other proteins in same PDB: d2btyb_, d2btyc_
   complexed with arg, k, nlg

Details for d2btya1

PDB Entry: 2bty, 2.75 Å

PDB Description: acetylglutamate kinase from thermotoga maritima complexed with its inhibitor arginine

PDB Compounds: (A:) acetylglutamate kinase

SCOPe Domain Sequences for d2btya1:

Sequence; same for both SEQRES and ATOM records:

>d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]}
mridtvnvllealpyikefygktfvikfggsamkqenakkafiqdiillkytgikpiivh
gggpaisqmmkdlgiepvfknghrvtdektmeivemvlvgkinkeivmnlnlhggravgi
cgkdsklivaeketkhgdigyvgkvkkvnpeilhaliendyipviapvgigedghsynin
adtaaaeiakslmaeklilltdvdgvlkdgklistltpdeaeelirdgtvtggmipkvec
avsavrggvgavhiingglehailleifsrkgigtmikeleg

Timeline for d2btya1:

• d2btya1 first appeared in SCOP 1.73
  
• d2btya1 appears in SCOPe 2.04
  
• d2btya1 appears in SCOPe 2.06
  
• d2btya1 appears in the current release, SCOPe 2.08