SCOPe 2.04: Domain d2btwa1: 2btw A:29-238

Lineage for d2btwa1 (2btw A:29-238)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.14: Phytochelatin synthase [142867] (1 protein)
   Pfam PF05023; assosiated Pfam PF09328 (DUF1984) is a part of the same functional unit

6. Protein Primitive phytochelatin synthase [142868] (1 species)

7. Species Nostoc sp. PCC 7120 [TaxId:103690] [142869] (2 PDB entries)
   Uniprot Q8YY76 29-238

8. Domain d2btwa1: 2btw A:29-238 [129159]
   complexed with ca

Details for d2btwa1

PDB Entry: 2btw, 2 Å

PDB Description: crystal structure of alr0975

PDB Compounds: (A:) alr0975 protein

SCOPe Domain Sequences for d2btwa1:

Sequence; same for both SEQRES and ATOM records:

>d2btwa1 d.3.1.14 (A:29-238) Primitive phytochelatin synthase {Nostoc sp. PCC 7120 [TaxId: 103690]}
lspnligfnsnegekllltsrsredffplsmqfvtqvnqaycgvasiimvlnslginape
taqyspyrvftqdnffsnektkaviapevvarqgmtldelgrliasygvkvkvnhasdtn
iedfrkqvaenlkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsrykyp
pvwvkttdlwkamntvdsvsqktrgfvfvs

Timeline for d2btwa1:

• d2btwa1 first appeared in SCOP 1.73
  
• d2btwa1 appears in SCOPe 2.03
  
• d2btwa1 appears in SCOPe 2.05
  
• d2btwa1 appears in the current release, SCOPe 2.08