![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Cyclin-dependent PK, CDK2 [88855] (2 species) CMGC group; CDKs subfamily; serine/threonine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88856] (124 PDB entries) |
![]() | Domain d2btra1: 2btr A:1-298 [129157] automatically matched to d1vywa_ complexed with u73 |
PDB Entry: 2btr (more details), 1.85 Å
SCOP Domain Sequences for d2btra1:
Sequence, based on SEQRES records: (download)
>d2btra1 d.144.1.7 (A:1-298) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh pnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchs hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl
>d2btra1 d.144.1.7 (A:1-298) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} menfqkvekigegtygvvykarnkltgevvalkkitaireisllkelnhpnivklldvih tenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchshrvlhrdlkpq nllintegaikladfglaevvtlwyrapeillgckyystavdiwslgcifaemvtrralf pgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpkwarqdfskvvppldedgrsll sqmlhydpnkrisakaalahpffqdvtkpvphlrl
Timeline for d2btra1: