SCOPe 2.08: Domain d2btot_: 2bto T:

Lineage for d2btot_ (2bto T:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Escherichia coli [TaxId:562] [52836] (55 PDB entries)
   Uniprot P00274 ! Uniprot P00581

8. Domain d2btot_: 2bto T: [129156]
   Other proteins in same PDB: d2btoa1, d2btoa2, d2btob1, d2btob2
   automated match to d1xoa__
   complexed with gtp

Details for d2btot_

PDB Entry: 2bto, 2.5 Å

PDB Description: structure of btuba from prosthecobacter dejongeii

PDB Compounds: (T:) Thioredoxin 1

SCOPe Domain Sequences for d2btot_:

Sequence; same for both SEQRES and ATOM records:

>d2btot_ c.47.1.1 (T:) Thioredoxin {Escherichia coli [TaxId: 562]}
iihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidqn
pgtapkygirgiptlllfkngevaatkvgalskgqlkefldan

Timeline for d2btot_:

• d2btot_ first appeared in SCOP 1.73, called d2btot1
  
• d2btot_ appears in SCOPe 2.07