Lineage for d2bt6b1 (2bt6 B:5-108)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717622Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 717623Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 protein domains)
  6. 717712Protein Adrenodoxin [54310] (1 species)
  7. 717713Species Cow (Bos taurus) [TaxId:9913] [54311] (6 PDB entries)
  8. 717715Domain d2bt6b1: 2bt6 B:5-108 [129153]
    automatically matched to d1e6eb_
    complexed with fes, mg, rua

Details for d2bt6b1

PDB Entry: 2bt6 (more details), 1.5 Å

PDB Description: ru(bpy)2(mbpy)-modified bovine adrenodoxin
PDB Compounds: (B:) Adrenodoxin 1

SCOP Domain Sequences for d2bt6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bt6b1 d.15.4.1 (B:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]}
dkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlifeqhif
ekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvp

SCOP Domain Coordinates for d2bt6b1:

Click to download the PDB-style file with coordinates for d2bt6b1.
(The format of our PDB-style files is described here.)

Timeline for d2bt6b1: