Lineage for d2bt6a2 (2bt6 A:5-108)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933781Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2933918Protein automated matches [190231] (14 species)
    not a true protein
  7. 2933928Species Cow (Bos taurus) [TaxId:9913] [186995] (1 PDB entry)
  8. 2933929Domain d2bt6a2: 2bt6 A:5-108 [129152]
    Other proteins in same PDB: d2bt6a3
    automated match to d1l6ua_
    complexed with fes, mg, rua

Details for d2bt6a2

PDB Entry: 2bt6 (more details), 1.5 Å

PDB Description: ru(bpy)2(mbpy)-modified bovine adrenodoxin
PDB Compounds: (A:) Adrenodoxin 1

SCOPe Domain Sequences for d2bt6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bt6a2 d.15.4.1 (A:5-108) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlifeqhif
ekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvp

SCOPe Domain Coordinates for d2bt6a2:

Click to download the PDB-style file with coordinates for d2bt6a2.
(The format of our PDB-style files is described here.)

Timeline for d2bt6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bt6a3
View in 3D
Domains from other chains:
(mouse over for more information)
d2bt6b_