Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family) |
Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein) |
Protein Type II 3-dehydroquinate dehydratase [52306] (5 species) |
Species Streptomyces coelicolor [TaxId:1902] [52308] (7 PDB entries) |
Domain d2bt4a1: 2bt4 A:2-150 [129140] automatically matched to d1d0ih_ complexed with ca2, gol, po4, trs |
PDB Entry: 2bt4 (more details), 1.7 Å
SCOP Domain Sequences for d2bt4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bt4a1 c.23.13.1 (A:2-150) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor [TaxId: 1902]} rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy vsqradgvvagcgvqgyvfgveriaalag
Timeline for d2bt4a1: