SCOPe 2.08: Domain d2bt1a2: 2bt1 A:121-256

Lineage for d2bt1a2 (2bt1 A:121-256)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Monomeric viral dUTPase [141655] (1 species)
   related to the trimeric dUTPase domain by domain duplication, fusion and partial deletion; retains only one of the three ancestral active sites

7. Species Epstein-Barr virus [TaxId:10376] [141656] (2 PDB entries)
   Uniprot P03195 121-256! Uniprot P03195 4-116
   Human herpesvirus 4

8. Domain d2bt1a2: 2bt1 A:121-256 [129136]
   automated match to d2bsya2
   complexed with dup, mg

Details for d2bt1a2

PDB Entry: 2bt1, 2.7 Å

PDB Description: epstein barr virus dutpase in complex with a,b-imino dutp

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d2bt1a2:

Sequence; same for both SEQRES and ATOM records:

>d2bt1a2 b.85.4.1 (A:121-256) Monomeric viral dUTPase {Epstein-Barr virus [TaxId: 10376]}
gpinhpqypgdvgldvslpkdlalfphqtvsvtltvpppsiphhrptifgrsglamqgil
vkpcrwrrggvdvsltnfsdqtvflnkyrrfcqlvylhkhhltsfysphsdagvlgprsl
frwasctfeevpslam

Timeline for d2bt1a2:

• d2bt1a2 first appeared in SCOP 1.73
  
• d2bt1a2 appears in SCOPe 2.07