![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.4: dUTPase-like [51283] (2 families) ![]() forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
![]() | Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
![]() | Protein Monomeric viral dUTPase [141655] (1 species) related to the trimeric dUTPase domain by domain duplication, fusion and partial deletion; retains only one of the three ancestral active sites |
![]() | Species Epstein-Barr virus [TaxId:10376] [141656] (2 PDB entries) Uniprot P03195 121-256! Uniprot P03195 4-116 Human herpesvirus 4 |
![]() | Domain d2bt1a1: 2bt1 A:3-116 [129135] automated match to d2bsya1 complexed with dup, mg |
PDB Entry: 2bt1 (more details), 2.7 Å
SCOPe Domain Sequences for d2bt1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bt1a1 b.85.4.1 (A:3-116) Monomeric viral dUTPase {Epstein-Barr virus [TaxId: 10376]} acphiryafqndklllqqasvgrltlvnkttillrpmktttvdlglyarppeghglmlwg stsrpvtshvgiidpgytgelrlilqnqrrynstlrpselkihlaafryatpqm
Timeline for d2bt1a1: