SCOP 1.73: Domain d2bt0a1: 2bt0 A:16-223

Lineage for d2bt0a1 (2bt0 A:16-223)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (1 protein)

6. Protein HSP90 [55876] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55878] (35 PDB entries)

8. Domain d2bt0a1: 2bt0 A:16-223 [129133]
   automatically matched to d1osfa_
   complexed with ct5

Details for d2bt0a1

PDB Entry: 2bt0, 1.9 Å

PDB Description: novel, potent small molecule inhibitors of the molecular chaperone hsp90 discovered through structure-based design

PDB Compounds: (A:) heat shock protein hsp90-alpha

SCOP Domain Sequences for d2bt0a1:

Sequence; same for both SEQRES and ATOM records:

>d2bt0a1 d.122.1.1 (A:16-223) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfve

Timeline for d2bt0a1:

• d2bt0a1 is new in SCOP 1.73
  
• d2bt0a1 appears in SCOP 1.75
  
• d2bt0a1 appears in the current release, SCOPe 2.08, called d2bt0a_