SCOPe 2.06: Domain d2bszb_: 2bsz B:

Lineage for d2bszb_ (2bsz B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (20 species)
   not a true protein

7. Species Rhizobium loti [TaxId:381] [186994] (1 PDB entry)

8. Domain d2bszb_: 2bsz B: [129132]
   Other proteins in same PDB: d2bsza1
   automated match to d1gx3a_

Details for d2bszb_

PDB Entry: 2bsz, 2 Å

PDB Description: Structure of Mesorhizobium loti arylamine N-acetyltransferase 1

PDB Compounds: (B:) arylamine n-acetyltransferase 1

SCOPe Domain Sequences for d2bszb_:

Sequence, based on SEQRES records:

>d2bszb_ d.3.1.0 (B:) automated matches {Rhizobium loti [TaxId: 381]}
fdldaylarigytgprnasldtlkalhfahpqaipfenidpflgrpvrldlaalqdkivl
ggrggycfehnllfmhalkalgfevgglaarvlwgqsedaitarshmllrveldgrtyia
dvgfggltltaplllepgreqktphepfriveaddhfrlqaaiggdwrslyrfdlqpqye
vdysvtnyflstsptshflssviaaraapdrryalrgnrlsihhlggrteqteiataadl
adtlqgllgiiipdrtafeakvretkiv

Sequence, based on observed residues (ATOM records):

>d2bszb_ d.3.1.0 (B:) automated matches {Rhizobium loti [TaxId: 381]}
fdldaylarigytgprnasldtlkalhfahpqaipfenidpflgrpvrldlaalqdkivl
ggrggycfehnllfmhalkalgfevgglaarvlwgqsedaitarshmllrveldgrtyia
dvgfggltltaplllepgreqktphepfriveaddhfrlqaaiggdwrslyrfdlqpqye
vdysvtnyflstsptshflssviaaraapdrryalrgnrlsihhteqteiataadladtl
qgllgiiipdrtafeakvretkiv

Timeline for d2bszb_:

• d2bszb_ first appeared in SCOP 1.73, called d2bszb1
  
• d2bszb_ appears in SCOPe 2.05
  
• d2bszb_ appears in SCOPe 2.07
  
• d2bszb_ appears in the current release, SCOPe 2.08