Lineage for d2bswa1 (2bsw A:2-146)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533460Protein Probable acetyltransferase YitI [143670] (1 species)
  7. 2533461Species Bacillus licheniformis [TaxId:1402] [143671] (3 PDB entries)
    Uniprot Q65LG7 2-146
  8. 2533464Domain d2bswa1: 2bsw A:2-146 [129127]
    has a glyphosate N-acetyltransferase activity obtained by DNA shuffling
    complexed with cao, gol, so4

Details for d2bswa1

PDB Entry: 2bsw (more details), 1.63 Å

PDB Description: crystal structure of a glyphosate-n-acetyltransferase obtained by dna shuffling.
PDB Compounds: (A:) glyphosate n-acetyltransferase

SCOPe Domain Sequences for d2bswa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bswa1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]}
ievkpinaedtyelrhrilrpnqpieacmfesdllrgafhlggyyggklisiasfhqaeh
selqgqkqyqlrgmatlegyreqkagsslikhaeeilrkrgadllwcnartsasgyykkl
gfseqgevfdtppvgphilmykrit

SCOPe Domain Coordinates for d2bswa1:

Click to download the PDB-style file with coordinates for d2bswa1.
(The format of our PDB-style files is described here.)

Timeline for d2bswa1: