SCOP 1.73: Domain d2bsvd2: 2bsv D:1-181

Lineage for d2bsvd2 (2bsv D:1-181)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (62 PDB entries)

8. Domain d2bsvd2: 2bsv D:1-181 [129125]
   Other proteins in same PDB: d2bsva1, d2bsvb1, d2bsvd1, d2bsve1
   automatically matched to d1akja2

Details for d2bsvd2

PDB Entry: 2bsv, 1.6 Å

PDB Description: t cell cross-reactivity and conformational changes during tcr engagement

PDB Compounds: (D:) hla class I histocompatibility antigen

SCOP Domain Sequences for d2bsvd2:

Sequence; same for both SEQRES and ATOM records:

>d2bsvd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d2bsvd2:

• d2bsvd2 is new in SCOP 1.73
  
• d2bsvd2 does not appear in SCOP 1.75