![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species) |
![]() | Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (62 PDB entries) |
![]() | Domain d2bsvd2: 2bsv D:1-181 [129125] Other proteins in same PDB: d2bsva1, d2bsvb1, d2bsvd1, d2bsve1 automatically matched to d1akja2 |
PDB Entry: 2bsv (more details), 1.6 Å
SCOP Domain Sequences for d2bsvd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bsvd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d2bsvd2:
![]() Domains from other chains: (mouse over for more information) d2bsva1, d2bsva2, d2bsvb1, d2bsve1 |