SCOP 1.73: Domain d2bsvd1: 2bsv D:182-276

Lineage for d2bsvd1 (2bsv D:182-276)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)

8. Domain d2bsvd1: 2bsv D:182-276 [129124]
   Other proteins in same PDB: d2bsva2, d2bsvb1, d2bsvd2, d2bsve1
   automatically matched to d1akja1

Details for d2bsvd1

PDB Entry: 2bsv, 1.6 Å

PDB Description: t cell cross-reactivity and conformational changes during tcr engagement

PDB Compounds: (D:) hla class I histocompatibility antigen

SCOP Domain Sequences for d2bsvd1:

Sequence; same for both SEQRES and ATOM records:

>d2bsvd1 b.1.1.2 (D:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwep

Timeline for d2bsvd1:

• d2bsvd1 is new in SCOP 1.73
  
• d2bsvd1 became obsolete in SCOP 1.75