SCOP 1.75: Domain d2bssa2: 2bss A:1-181

Lineage for d2bssa2 (2bss A:1-181)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (12 PDB entries)
   Uniprot P30481 25-300

8. Domain d2bssa2: 2bss A:1-181 [129110]
   Other proteins in same PDB: d2bssa1, d2bssb1
   automatically matched to d1m6oa2

Details for d2bssa2

PDB Entry: 2bss, 2 Å

PDB Description: crystal structures and kir3dl1 recognition of three immunodominant viral peptides complexed to hla-b2705

PDB Compounds: (A:) hla class I histocompatibility antigen b-27 alpha chain

SCOP Domain Sequences for d2bssa2:

Sequence; same for both SEQRES and ATOM records:

>d2bssa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqnaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

Timeline for d2bssa2:

• d2bssa2 first appeared in SCOP 1.73
  
• d2bssa2 appears in SCOPe 2.01
  
• d2bssa2 appears in the current release, SCOPe 2.08