Lineage for d2bsra2 (2bsr A:1-181)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719393Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 719564Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (10 PDB entries)
  8. 719573Domain d2bsra2: 2bsr A:1-181 [129107]
    Other proteins in same PDB: d2bsra1, d2bsrb1
    automatically matched to d1m6oa2

Details for d2bsra2

PDB Entry: 2bsr (more details), 2.3 Å

PDB Description: crystal structures and kir3dl1 recognition of three immunodominant viral peptides complexed to hla-b2705
PDB Compounds: (A:) hla class I histocompatibility antigen, b-27 alpha chain precursor

SCOP Domain Sequences for d2bsra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bsra2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqnaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

SCOP Domain Coordinates for d2bsra2:

Click to download the PDB-style file with coordinates for d2bsra2.
(The format of our PDB-style files is described here.)

Timeline for d2bsra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bsra1
View in 3D
Domains from other chains:
(mouse over for more information)
d2bsrb1