Lineage for d2bsma1 (2bsm A:16-223)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732553Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 732554Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 732555Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (1 protein)
  6. 732556Protein HSP90 [55876] (3 species)
  7. 732609Species Human (Homo sapiens) [TaxId:9606] [55878] (35 PDB entries)
  8. 732639Domain d2bsma1: 2bsm A:16-223 [129097]
    automatically matched to d1osfa_
    complexed with bsm

Details for d2bsma1

PDB Entry: 2bsm (more details), 2.05 Å

PDB Description: novel, potent small molecule inhibitors of the molecular chaperone hsp90 discovered through structure-based design
PDB Compounds: (A:) heat shock protein hsp90-alpha

SCOP Domain Sequences for d2bsma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bsma1 d.122.1.1 (A:16-223) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfve

SCOP Domain Coordinates for d2bsma1:

Click to download the PDB-style file with coordinates for d2bsma1.
(The format of our PDB-style files is described here.)

Timeline for d2bsma1: