Lineage for d2bslb1 (2bsl B:1-311)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 814735Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 814736Family c.1.4.1: FMN-linked oxidoreductases [51396] (18 proteins)
  6. 814782Protein Dihydroorotate dehydrogenase [51397] (7 species)
  7. 814800Species Lactococcus lactis, isozyme A [TaxId:1358] [51398] (11 PDB entries)
  8. 814822Domain d2bslb1: 2bsl B:1-311 [129096]
    automatically matched to d1dora_
    complexed with act, dhb, fmn, gol, mg

Details for d2bslb1

PDB Entry: 2bsl (more details), 2.3 Å

PDB Description: crystal structure of l. lactis dihydroorotate dehydrogense a in complex with 3,4-dihydroxybenzoate
PDB Compounds: (B:) dihydroorotate dehydrogenase a

SCOP Domain Sequences for d2bslb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bslb1 c.1.4.1 (B:1-311) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]}
mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
iadfhgklksl

SCOP Domain Coordinates for d2bslb1:

Click to download the PDB-style file with coordinates for d2bslb1.
(The format of our PDB-style files is described here.)

Timeline for d2bslb1: