Lineage for d2bskb1 (2bsk B:13-77)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 752106Fold g.83: Tim10-like [144121] (1 superfamily)
    alpha-hairpin crosslinked by two disulfides; assembles into a heterohexameric ring-like structure
  4. 752107Superfamily g.83.1: Tim10-like [144122] (1 family) (S)
  5. 752108Family g.83.1.1: Tim10/DDP [144123] (2 proteins)
    Pfam PF02953; note: not a zinc finger
  6. 752109Protein Mitochondrial import inner membrane translocase subunit Tim10 [144126] (1 species)
  7. 752110Species Human (Homo sapiens) [TaxId:9606] [144127] (1 PDB entry)
  8. 752111Domain d2bskb1: 2bsk B:13-77 [129091]
    Other proteins in same PDB: d2bska1, d2bskc1

Details for d2bskb1

PDB Entry: 2bsk (more details), 3.3 Å

PDB Description: crystal structure of the tim9 tim10 hexameric complex
PDB Compounds: (B:) mitochondrial import inner membrane translocase subunit tim10

SCOP Domain Sequences for d2bskb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bskb1 g.83.1.1 (B:13-77) Mitochondrial import inner membrane translocase subunit Tim10 {Human (Homo sapiens) [TaxId: 9606]}
levemmadmynrmtsachrkcvpphykeaelskgesvcldrcvskyldihermgkkltel
smqde

SCOP Domain Coordinates for d2bskb1:

Click to download the PDB-style file with coordinates for d2bskb1.
(The format of our PDB-style files is described here.)

Timeline for d2bskb1: