Lineage for d2bska1 (2bsk A:13-85)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2643421Fold g.83: Tim10-like [144121] (1 superfamily)
    alpha-hairpin crosslinked by two disulfides; assembles into a heterohexameric ring-like structure
  4. 2643422Superfamily g.83.1: Tim10-like [144122] (2 families) (S)
  5. 2643423Family g.83.1.1: Tim10/DDP [144123] (2 proteins)
    Pfam PF02953; note: not a zinc finger
  6. 2643429Protein Mitochondrial import inner membrane translocase subunit Tim9 [144124] (1 species)
  7. 2643430Species Human (Homo sapiens) [TaxId:9606] [144125] (1 PDB entry)
    Uniprot Q9Y5J7 13-85
  8. 2643431Domain d2bska1: 2bsk A:13-85 [129090]
    Other proteins in same PDB: d2bskb1, d2bskd1, d2bskf1

Details for d2bska1

PDB Entry: 2bsk (more details), 3.3 Å

PDB Description: crystal structure of the tim9 tim10 hexameric complex
PDB Compounds: (A:) mitochondrial import inner membrane translocase subunit tim9 a

SCOPe Domain Sequences for d2bska1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bska1 g.83.1.1 (A:13-85) Mitochondrial import inner membrane translocase subunit Tim9 {Human (Homo sapiens) [TaxId: 9606]}
qfkeflgtynkltetcfldcvkdfttrevkpeettcsehclqkylkmtqrismrfqeyhi
qqnealaakagll

SCOPe Domain Coordinates for d2bska1:

Click to download the PDB-style file with coordinates for d2bska1.
(The format of our PDB-style files is described here.)

Timeline for d2bska1: