Lineage for d2bsdb3 (2bsd B:2-140)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1336653Fold b.163: Pseudo beta-prism [141657] (1 superfamily)
    beta-sandwich with one regular beta-sheet and the other beta-sheet bent in the middle with a set of aligned beta-bulges
  4. 1336654Superfamily b.163.1: Bacteriophage trimeric proteins domain [141658] (2 families) (S)
    found in phage proteins that form trimers, but is not involved in the trimerisation
  5. 1336671Family b.163.1.2: Lactophage receptor-binding protein N-terminal domain [141662] (1 protein)
    automatically mapped to Pfam PF08931
  6. 1336672Protein Receptor binding protein, rbp, N-terminal domain [141663] (1 species)
    includes extra N-terminal trimerization helix
  7. 1336673Species Lactococcus lactis phage p2 [TaxId:100641] [141664] (2 PDB entries)
    Uniprot Q71AW2 2-140
  8. 1336678Domain d2bsdb3: 2bsd B:2-140 [129086]
    Other proteins in same PDB: d2bsda1, d2bsda2, d2bsdb1, d2bsdb2, d2bsdc1, d2bsdc2
    automated match to d1zrua3

Details for d2bsdb3

PDB Entry: 2bsd (more details), 2.3 Å

PDB Description: structure of lactococcal bacteriophage p2 receptor binding protein
PDB Compounds: (B:) receptor binding protein

SCOPe Domain Sequences for d2bsdb3:

Sequence, based on SEQRES records: (download)

>d2bsdb3 b.163.1.2 (B:2-140) Receptor binding protein, rbp, N-terminal domain {Lactococcus lactis phage p2 [TaxId: 100641]}
tiknftffspnstefpvgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsii
aggryfellnetvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlkv
cfdivttsgtgvtstkpiv

Sequence, based on observed residues (ATOM records): (download)

>d2bsdb3 b.163.1.2 (B:2-140) Receptor binding protein, rbp, N-terminal domain {Lactococcus lactis phage p2 [TaxId: 100641]}
tiknftffgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsiiaggryfell
netvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlkvcfdivttsg
tgvtstkpiv

SCOPe Domain Coordinates for d2bsdb3:

Click to download the PDB-style file with coordinates for d2bsdb3.
(The format of our PDB-style files is described here.)

Timeline for d2bsdb3: