![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.163: Pseudo beta-prism [141657] (1 superfamily) beta-sandwich with one regular beta-sheet and the other beta-sheet bent in the middle with a set of aligned beta-bulges |
![]() | Superfamily b.163.1: Bacteriophage trimeric proteins domain [141658] (2 families) ![]() found in phage proteins that form trimers, but is not involved in the trimerisation |
![]() | Family b.163.1.2: Lactophage receptor-binding protein N-terminal domain [141662] (1 protein) |
![]() | Protein Receptor binding protein, rbp, N-terminal domain [141663] (1 species) includes extra N-terminal trimerization helix |
![]() | Species Lactococcus lactis phage p2 [TaxId:100641] [141664] (2 PDB entries) |
![]() | Domain d2bsda3: 2bsd A:2-140 [129083] Other proteins in same PDB: d2bsda1, d2bsda2, d2bsdb1, d2bsdb2, d2bsdc1, d2bsdc2 automatically matched to 1ZRU A:2-140 |
PDB Entry: 2bsd (more details), 2.3 Å
SCOP Domain Sequences for d2bsda3:
Sequence, based on SEQRES records: (download)
>d2bsda3 b.163.1.2 (A:2-140) Receptor binding protein, rbp, N-terminal domain {Lactococcus lactis phage p2 [TaxId: 100641]} tiknftffspnstefpvgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsii aggryfellnetvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlkv cfdivttsgtgvtstkpiv
>d2bsda3 b.163.1.2 (A:2-140) Receptor binding protein, rbp, N-terminal domain {Lactococcus lactis phage p2 [TaxId: 100641]} tiknftffgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsiiaggryfell netvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlkvcfdivttsg tgvtstkpiv
Timeline for d2bsda3: