![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins) interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain |
![]() | Protein Beta-D-xylosidase [101926] (2 species) glycosyl hydrolase family 39 |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [141555] (3 PDB entries) |
![]() | Domain d2bs9g1: 2bs9 G:4-13,G:361-502 [129074] Other proteins in same PDB: d2bs9a2, d2bs9b2, d2bs9c2, d2bs9d2, d2bs9e2, d2bs9f2, d2bs9g2, d2bs9h2 automatically matched to 2BS9 A:4-13,A:361-502 complexed with ca |
PDB Entry: 2bs9 (more details), 2.2 Å
SCOP Domain Sequences for d2bs9g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bs9g1 b.71.1.2 (G:4-13,G:361-502) Beta-D-xylosidase {Bacillus stearothermophilus [TaxId: 1422]} vnvpsngrekXellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsesav fikrqivneqygnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsiv lsknevtlieieqvrdetstyvglddgeitsys
Timeline for d2bs9g1: