SCOPe 2.08: Domain d2bs9d2: 2bs9 D:14-360

Lineage for d2bs9d2 (2bs9 D:14-360)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Beta-D-xylosidase, catalytic domain [102077] (2 species)
   glycosyl hydrolase family 39

7. Species Bacillus stearothermophilus [TaxId:1422] [141780] (3 PDB entries)
   Uniprot Q9ZFM2 15-361

8. Domain d2bs9d2: 2bs9 D:14-360 [129069]
   Other proteins in same PDB: d2bs9a1, d2bs9b1, d2bs9c1, d2bs9d1, d2bs9e1, d2bs9f1, d2bs9g1, d2bs9h1
   automated match to d2bs9a2
   complexed with ca

Details for d2bs9d2

PDB Entry: 2bs9, 2.2 Å

PDB Description: Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus

PDB Compounds: (D:) beta-xylosidase

SCOPe Domain Sequences for d2bs9d2:

Sequence; same for both SEQRES and ATOM records:

>d2bs9d2 c.1.8.3 (D:14-360) Beta-D-xylosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]}
fkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddvgiyreveidgem
kpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnvtppkdynkwrdl
ivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklyevtaravksvdphl
qvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfeyyyqeleppedm
leqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiarilseggdyvdsf
sywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd

Timeline for d2bs9d2:

• d2bs9d2 first appeared in SCOP 1.73
  
• d2bs9d2 appears in SCOPe 2.07