![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
![]() | Protein Fumarate reductase iron-sulfur protein, N-terminal domain [54325] (3 species) |
![]() | Species Wolinella succinogenes [TaxId:844] [54327] (5 PDB entries) |
![]() | Domain d2bs4e2: 2bs4 E:1-106 [129061] Other proteins in same PDB: d2bs4a1, d2bs4a2, d2bs4a3, d2bs4b1, d2bs4c1, d2bs4d1, d2bs4d2, d2bs4d3, d2bs4e1, d2bs4f_ automated match to d1e7pb2 complexed with cit, dmw, f3s, fad, fes, hem, lmt, na, sf4 |
PDB Entry: 2bs4 (more details), 2.76 Å
SCOPe Domain Sequences for d2bs4e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bs4e2 d.15.4.2 (E:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} mgrmltirvfkydpqsavskphfqeykieeapsmtifivlnmiretydpdlnfdfvcrag icgscgmmingrpslacrtltkdfedgvitllplpafklikdlsvd
Timeline for d2bs4e2: