Lineage for d2bs4e2 (2bs4 E:1-106)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. Protein Fumarate reductase iron-sulfur protein, N-terminal domain [54325] (3 species)
  7. Species Wolinella succinogenes [TaxId:844] [54327] (5 PDB entries)
  8. Domain d2bs4e2: 2bs4 E:1-106 [129061]
    Other proteins in same PDB: d2bs4a1, d2bs4a2, d2bs4a3, d2bs4b1, d2bs4c1, d2bs4d1, d2bs4d2, d2bs4d3, d2bs4e1, d2bs4f_
    automated match to d1e7pb2
    complexed with cit, dmw, f3s, fad, fes, hem, lmt, na, sf4

Details for d2bs4e2

PDB Entry: 2bs4 (more details), 2.76 Å

PDB Description: glu c180 -> ile variant quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (E:) quinol-fumarate reductase iron-sulfur subunit b

SCOPe Domain Sequences for d2bs4e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bs4e2 d.15.4.2 (E:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]}
mgrmltirvfkydpqsavskphfqeykieeapsmtifivlnmiretydpdlnfdfvcrag
icgscgmmingrpslacrtltkdfedgvitllplpafklikdlsvd

SCOPe Domain Coordinates for d2bs4e2 are not available.

Timeline for d2bs4e2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bs4e1
View in 3D
Domains from other chains:
(mouse over for more information)
d2bs4a1, d2bs4a2, d2bs4a3, d2bs4b1, d2bs4b2, d2bs4c1, d2bs4d1, d2bs4d2, d2bs4d3, d2bs4f_