Lineage for d2bs4d3 (2bs4 D:251-371)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607180Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 2607181Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 2607182Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 2607221Protein Fumarate reductase [56429] (2 species)
  7. 2607233Species Wolinella succinogenes [TaxId:844] [56431] (6 PDB entries)
  8. 2607243Domain d2bs4d3: 2bs4 D:251-371 [129059]
    Other proteins in same PDB: d2bs4a1, d2bs4a2, d2bs4b1, d2bs4b2, d2bs4c1, d2bs4d1, d2bs4d2, d2bs4e1, d2bs4e2, d2bs4f_
    automated match to d1e7pa3
    complexed with cit, dmw, f3s, fad, fes, hem, lmt, na, sf4

Details for d2bs4d3

PDB Entry: 2bs4 (more details), 2.76 Å

PDB Description: glu c180 -> ile variant quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (D:) quinol-fumarate reductase flavoprotein subunit a

SCOPe Domain Sequences for d2bs4d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bs4d3 d.168.1.1 (D:251-371) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
meavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelasrdvvsrrmie
hirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaekwapvlpmqhy
s

SCOPe Domain Coordinates for d2bs4d3:

Click to download the PDB-style file with coordinates for d2bs4d3.
(The format of our PDB-style files is described here.)

Timeline for d2bs4d3: