Lineage for d2bs4d2 (2bs4 D:1-250,D:372-457)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 688694Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 688695Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (7 families) (S)
  5. 689033Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 proteins)
  6. 689072Protein Fumarate reductase [51937] (2 species)
  7. 689082Species Wolinella succinogenes [TaxId:844] [51939] (5 PDB entries)
  8. 689088Domain d2bs4d2: 2bs4 D:1-250,D:372-457 [129058]
    Other proteins in same PDB: d2bs4a1, d2bs4a3, d2bs4b1, d2bs4b2, d2bs4d1, d2bs4d3, d2bs4e1, d2bs4e2
    automatically matched to d1e7pa2
    complexed with cit, dmw, f3s, fad, fes, hem, lmt, na, sf4

Details for d2bs4d2

PDB Entry: 2bs4 (more details), 2.76 Å

PDB Description: glu c180 -> ile variant quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (D:) quinol-fumarate reductase flavoprotein subunit a

SCOP Domain Sequences for d2bs4d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bs4d2 c.3.1.4 (D:1-250,D:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
mkvqycdslviggglaglraavatqqkglstivlslipvkrshsaaaqggmqaslgnskm
sdgdnedlhfmdtvkgsdwgcdqkvarmfvntapkairelaawgvpwtrihkgdrmaiin
aqkttiteedfrhglihsrdfggtkkwrtcytadatghtmlfavaneclklgvsiqdrke
aialihqdgkcygavvrdlvtgdiiayvakgtliatggygriyknttnavvcegtgtaia
letgiaqlgnXmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmiv
geyfaehcantqvdletktlekfvkgqeaymkslves

SCOP Domain Coordinates for d2bs4d2:

Click to download the PDB-style file with coordinates for d2bs4d2.
(The format of our PDB-style files is described here.)

Timeline for d2bs4d2: