Lineage for d2bs4d1 (2bs4 D:458-656)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309866Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2309960Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 2309961Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 2309968Protein Fumarate reductase [46981] (2 species)
  7. 2309980Species Wolinella succinogenes [TaxId:844] [46983] (6 PDB entries)
  8. 2309990Domain d2bs4d1: 2bs4 D:458-656 [129057]
    Other proteins in same PDB: d2bs4a2, d2bs4a3, d2bs4b1, d2bs4b2, d2bs4c1, d2bs4d2, d2bs4d3, d2bs4e1, d2bs4e2, d2bs4f_
    automated match to d1e7pa1
    complexed with cit, dmw, f3s, fad, fes, hem, lmt, na, sf4

Details for d2bs4d1

PDB Entry: 2bs4 (more details), 2.76 Å

PDB Description: glu c180 -> ile variant quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (D:) quinol-fumarate reductase flavoprotein subunit a

SCOPe Domain Sequences for d2bs4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bs4d1 a.7.3.1 (D:458-656) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
kgtedvfkiknrmkdvmddnvgifrdgphlekavkeleelykksknvgiknkrlhanpel
eeayrvpmmlkvalcvakgaldrtesrgahnredypkrddinwlnrtlaswpnpeqtlpt
leyealdvnemeiapgyrgygakgnyienplsvkrqeeidkiqseleaagkdrhaiqeal
mpyelpakykarnerlgdk

SCOPe Domain Coordinates for d2bs4d1:

Click to download the PDB-style file with coordinates for d2bs4d1.
(The format of our PDB-style files is described here.)

Timeline for d2bs4d1: