Lineage for d2bs4b2 (2bs4 B:1-106)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2540890Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2541095Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2541153Protein Fumarate reductase iron-sulfur protein, N-terminal domain [54325] (3 species)
  7. 2541170Species Wolinella succinogenes [TaxId:844] [54327] (5 PDB entries)
  8. 2541177Domain d2bs4b2: 2bs4 B:1-106 [129056]
    Other proteins in same PDB: d2bs4a1, d2bs4a2, d2bs4a3, d2bs4b1, d2bs4c1, d2bs4d1, d2bs4d2, d2bs4d3, d2bs4e1, d2bs4f_
    automated match to d1e7pb2
    complexed with cit, dmw, f3s, fad, fes, hem, lmt, na, sf4

Details for d2bs4b2

PDB Entry: 2bs4 (more details), 2.76 Å

PDB Description: glu c180 -> ile variant quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (B:) quinol-fumarate reductase iron-sulfur subunit b

SCOPe Domain Sequences for d2bs4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bs4b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]}
mgrmltirvfkydpqsavskphfqeykieeapsmtifivlnmiretydpdlnfdfvcrag
icgscgmmingrpslacrtltkdfedgvitllplpafklikdlsvd

SCOPe Domain Coordinates for d2bs4b2:

Click to download the PDB-style file with coordinates for d2bs4b2.
(The format of our PDB-style files is described here.)

Timeline for d2bs4b2: