Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) contains two Fe4-S4 clusters |
Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
Protein Fumarate reductase [46550] (3 species) |
Species Wolinella succinogenes [TaxId:844] [46552] (5 PDB entries) |
Domain d2bs4b1: 2bs4 B:107-239 [129055] Other proteins in same PDB: d2bs4a1, d2bs4a2, d2bs4a3, d2bs4b2, d2bs4c1, d2bs4d1, d2bs4d2, d2bs4d3, d2bs4e2, d2bs4f_ automated match to d1e7pb1 complexed with cit, dmw, f3s, fad, fes, hem, lmt, na, sf4 |
PDB Entry: 2bs4 (more details), 2.76 Å
SCOPe Domain Sequences for d2bs4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bs4b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} tgnwfngmsqrveswihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkim redfvgaaglnrvvrfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqs kiaylrrkmvsvn
Timeline for d2bs4b1: