![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) ![]() contains two Fe4-S4 clusters |
![]() | Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (2 proteins) |
![]() | Protein Fumarate reductase [46550] (2 species) |
![]() | Species Wolinella succinogenes [TaxId:844] [46552] (5 PDB entries) |
![]() | Domain d2bs3e1: 2bs3 E:107-239 [129050] Other proteins in same PDB: d2bs3a1, d2bs3a2, d2bs3a3, d2bs3b2, d2bs3d1, d2bs3d2, d2bs3d3, d2bs3e2 automatically matched to d1e7pb1 complexed with cit, f3s, fad, fes, hem, lmt, na, sf4 |
PDB Entry: 2bs3 (more details), 2.19 Å
SCOP Domain Sequences for d2bs3e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bs3e1 a.1.2.1 (E:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} tgnwfngmsqrveswihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkim redfvgaaglnrvvrfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqs kiaylrrkmvsvn
Timeline for d2bs3e1: