Lineage for d2bs3d1 (2bs3 D:458-656)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696597Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 2696598Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 2696605Protein Fumarate reductase [46981] (2 species)
  7. 2696617Species Wolinella succinogenes [TaxId:844] [46983] (6 PDB entries)
  8. 2696621Domain d2bs3d1: 2bs3 D:458-656 [129047]
    Other proteins in same PDB: d2bs3a2, d2bs3a3, d2bs3b1, d2bs3b2, d2bs3c1, d2bs3d2, d2bs3d3, d2bs3e1, d2bs3e2, d2bs3f_
    automated match to d1e7pa1
    complexed with cit, f3s, fad, fes, hem, lmt, na, sf4
    has additional insertions and/or extensions that are not grouped together

Details for d2bs3d1

PDB Entry: 2bs3 (more details), 2.19 Å

PDB Description: glu c180 -> gln variant quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (D:) quinol-fumarate reductase flavoprotein subunit a

SCOPe Domain Sequences for d2bs3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bs3d1 a.7.3.1 (D:458-656) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
kgtedvfkiknrmkdvmddnvgifrdgphlekavkeleelykksknvgiknkrlhanpel
eeayrvpmmlkvalcvakgaldrtesrgahnredypkrddinwlnrtlaswpnpeqtlpt
leyealdvnemeiapgyrgygakgnyienplsvkrqeeidkiqseleaagkdrhaiqeal
mpyelpakykarnerlgdk

SCOPe Domain Coordinates for d2bs3d1:

Click to download the PDB-style file with coordinates for d2bs3d1.
(The format of our PDB-style files is described here.)

Timeline for d2bs3d1: