![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins) |
![]() | Protein Fumarate reductase iron-sulfur protein, N-terminal domain [54325] (2 species) |
![]() | Species Wolinella succinogenes [TaxId:844] [54327] (5 PDB entries) |
![]() | Domain d2bs3b2: 2bs3 B:1-106 [129046] Other proteins in same PDB: d2bs3a1, d2bs3a2, d2bs3a3, d2bs3b1, d2bs3c1, d2bs3d1, d2bs3d2, d2bs3d3, d2bs3e1, d2bs3f1 automatically matched to d1e7pb2 complexed with cit, f3s, fad, fes, hem, lmt, na, sf4 |
PDB Entry: 2bs3 (more details), 2.19 Å
SCOP Domain Sequences for d2bs3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bs3b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} mgrmltirvfkydpqsavskphfqeykieeapsmtifivlnmiretydpdlnfdfvcrag icgscgmmingrpslacrtltkdfedgvitllplpafklikdlsvd
Timeline for d2bs3b2: