Lineage for d2bs3b2 (2bs3 B:1-106)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933988Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2934046Protein Fumarate reductase iron-sulfur protein, N-terminal domain [54325] (3 species)
  7. 2934063Species Wolinella succinogenes [TaxId:844] [54327] (5 PDB entries)
  8. 2934064Domain d2bs3b2: 2bs3 B:1-106 [129046]
    Other proteins in same PDB: d2bs3a1, d2bs3a2, d2bs3a3, d2bs3b1, d2bs3c1, d2bs3d1, d2bs3d2, d2bs3d3, d2bs3e1, d2bs3f_
    automated match to d1e7pb2
    complexed with cit, f3s, fad, fes, hem, lmt, na, sf4

Details for d2bs3b2

PDB Entry: 2bs3 (more details), 2.19 Å

PDB Description: glu c180 -> gln variant quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (B:) quinol-fumarate reductase iron-sulfur subunit b

SCOPe Domain Sequences for d2bs3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bs3b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]}
mgrmltirvfkydpqsavskphfqeykieeapsmtifivlnmiretydpdlnfdfvcrag
icgscgmmingrpslacrtltkdfedgvitllplpafklikdlsvd

SCOPe Domain Coordinates for d2bs3b2:

Click to download the PDB-style file with coordinates for d2bs3b2.
(The format of our PDB-style files is described here.)

Timeline for d2bs3b2: