Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily) unusual fold |
Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) |
Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins) |
Protein Fumarate reductase [56429] (2 species) |
Species Wolinella succinogenes [TaxId:844] [56431] (6 PDB entries) |
Domain d2bs2d3: 2bs2 D:251-371 [129038] Other proteins in same PDB: d2bs2a1, d2bs2a2, d2bs2b1, d2bs2b2, d2bs2c_, d2bs2d1, d2bs2d2, d2bs2e1, d2bs2e2, d2bs2f_ automatically matched to d1e7pa3 complexed with f3s, fad, fes, fum, hem, lmt, na, sf4 |
PDB Entry: 2bs2 (more details), 1.78 Å
SCOPe Domain Sequences for d2bs2d3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bs2d3 d.168.1.1 (D:251-371) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} meavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelasrdvvsrrmie hirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaekwapvlpmqhy s
Timeline for d2bs2d3: