![]() | Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) ![]() two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
![]() | Family f.21.2.1: Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56910] (1 protein) duplication: consists of two structural repeats; the heme-binding sites are related by pseudo two fold symmetry |
![]() | Protein Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56911] (1 species) |
![]() | Species Wolinella succinogenes [TaxId:844] [56913] (3 PDB entries) |
![]() | Domain d2bs2c1: 2bs2 C:1-254 [129035] Other proteins in same PDB: d2bs2a1, d2bs2a2, d2bs2a3, d2bs2b1, d2bs2b2, d2bs2d1, d2bs2d2, d2bs2d3, d2bs2e1, d2bs2e2 automatically matched to d1qlac_ complexed with f3s, fad, fes, fmr, hem, lmt, na, sf4 |
PDB Entry: 2bs2 (more details), 1.78 Å
SCOP Domain Sequences for d2bs2c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bs2c1 f.21.2.1 (C:1-254) Fumarate reductase respiratory complex cytochrome b subunit, FrdC {Wolinella succinogenes [TaxId: 844]} mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd pnidykyfdykrth
Timeline for d2bs2c1: