Lineage for d2bs2c1 (2bs2 C:1-254)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745424Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 745476Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 745477Family f.21.2.1: Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56910] (1 protein)
    duplication: consists of two structural repeats; the heme-binding sites are related by pseudo two fold symmetry
  6. 745478Protein Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56911] (1 species)
  7. 745479Species Wolinella succinogenes [TaxId:844] [56913] (3 PDB entries)
  8. 745480Domain d2bs2c1: 2bs2 C:1-254 [129035]
    Other proteins in same PDB: d2bs2a1, d2bs2a2, d2bs2a3, d2bs2b1, d2bs2b2, d2bs2d1, d2bs2d2, d2bs2d3, d2bs2e1, d2bs2e2
    automatically matched to d1qlac_
    complexed with f3s, fad, fes, fmr, hem, lmt, na, sf4

Details for d2bs2c1

PDB Entry: 2bs2 (more details), 1.78 Å

PDB Description: quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (C:) quinol-fumarate reductase diheme cytochrome b subunit c

SCOP Domain Sequences for d2bs2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bs2c1 f.21.2.1 (C:1-254) Fumarate reductase respiratory complex cytochrome b subunit, FrdC {Wolinella succinogenes [TaxId: 844]}
mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave
lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
pnidykyfdykrth

SCOP Domain Coordinates for d2bs2c1:

Click to download the PDB-style file with coordinates for d2bs2c1.
(The format of our PDB-style files is described here.)

Timeline for d2bs2c1: