Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
Family f.21.2.1: Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56910] (2 proteins) duplication: consists of two structural repeats; the heme-binding sites are related by pseudo two fold symmetry |
Protein automated matches [190227] (1 species) not a true protein |
Species Wolinella succinogenes [TaxId:844] [186991] (3 PDB entries) |
Domain d2bs2c_: 2bs2 C: [129035] Other proteins in same PDB: d2bs2a1, d2bs2a2, d2bs2a3, d2bs2b1, d2bs2b2, d2bs2d1, d2bs2d2, d2bs2d3, d2bs2e1, d2bs2e2 automated match to d1e7pc_ complexed with f3s, fad, fes, fum, hem, lmt, na, sf4 |
PDB Entry: 2bs2 (more details), 1.78 Å
SCOPe Domain Sequences for d2bs2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bs2c_ f.21.2.1 (C:) automated matches {Wolinella succinogenes [TaxId: 844]} mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd pnidykyfdykrthe
Timeline for d2bs2c_: