SCOP 1.73: Domain d2bs2b1: 2bs2 B:107-239

Lineage for d2bs2b1 (2bs2 B:107-239)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (2 proteins)

6. Protein Fumarate reductase [46550] (2 species)

7. Species Wolinella succinogenes [TaxId:844] [46552] (5 PDB entries)

8. Domain d2bs2b1: 2bs2 B:107-239 [129033]
   Other proteins in same PDB: d2bs2a1, d2bs2a2, d2bs2a3, d2bs2b2, d2bs2c1, d2bs2d1, d2bs2d2, d2bs2d3, d2bs2e2, d2bs2f1
   automatically matched to d1e7pb1
   complexed with f3s, fad, fes, fmr, hem, lmt, na, sf4

Details for d2bs2b1

PDB Entry: 2bs2, 1.78 Å

PDB Description: quinol:fumarate reductase from wolinella succinogenes

PDB Compounds: (B:) quinol-fumarate reductase iron-sulfur subunit b

SCOP Domain Sequences for d2bs2b1:

Sequence; same for both SEQRES and ATOM records:

>d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
tgnwfngmsqrveswihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkim
redfvgaaglnrvvrfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqs
kiaylrrkmvsvn

Timeline for d2bs2b1:

• d2bs2b1 is new in SCOP 1.73
  
• d2bs2b1 appears in SCOP 1.75
  
• d2bs2b1 appears in the current release, SCOPe 2.08