SCOPe 2.06: Domain d2brxb2: 2brx B:1-225

Lineage for d2brxb2 (2brx B:1-225)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.3: PyrH-like [142721] (4 proteins)
   part of Pfam PF00696

6. Protein automated matches [190400] (4 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [187472] (4 PDB entries)

8. Domain d2brxb2: 2brx B:1-225 [129029]
   Other proteins in same PDB: d2brxa1, d2brxa2, d2brxb3
   automated match to d2bmua1

Details for d2brxb2

PDB Entry: 2brx, 2.4 Å

PDB Description: ump kinase from pyrococcus furiosus without ligands

PDB Compounds: (B:) uridylate kinase

SCOPe Domain Sequences for d2brxb2:

Sequence, based on SEQRES records:

>d2brxb2 c.73.1.3 (B:1-225) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekfns
setfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpghtt
davaallaeflkadllvvitnvdgvytadpkkdptakkikkmkpeelleivgkgiekags
ssvidplaakiiarsgiktivigkedakdlfrvikgdhngttiep

Sequence, based on observed residues (ATOM records):

>d2brxb2 c.73.1.3 (B:1-225) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekfns
setfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpghtt
davaallaeflkadllvvitnvdgvyakkikkmkpeelleivgksvidplaakiiarsgi
ktivigkedakdlfrvikgdhngttiep

Timeline for d2brxb2:

• d2brxb2 first appeared in SCOP 1.73, called d2brxb1
  
• d2brxb2 was called d2brxb_ in SCOPe 2.05
  
• d2brxb2 appears in SCOPe 2.07
  
• d2brxb2 appears in the current release, SCOPe 2.08