Lineage for d2brxb2 (2brx B:1-225)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138062Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2138063Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2138140Family c.73.1.3: PyrH-like [142721] (4 protein domains)
    part of Pfam PF00696
  6. 2138183Protein automated matches [190400] (4 species)
    not a true protein
  7. 2138208Species Pyrococcus furiosus [TaxId:2261] [187472] (4 PDB entries)
  8. 2138209Domain d2brxb2: 2brx B:1-225 [129029]
    Other proteins in same PDB: d2brxa1, d2brxa2, d2brxb3
    automated match to d2bmua1

Details for d2brxb2

PDB Entry: 2brx (more details), 2.4 Å

PDB Description: ump kinase from pyrococcus furiosus without ligands
PDB Compounds: (B:) uridylate kinase

SCOPe Domain Sequences for d2brxb2:

Sequence, based on SEQRES records: (download)

>d2brxb2 c.73.1.3 (B:1-225) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekfns
setfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpghtt
davaallaeflkadllvvitnvdgvytadpkkdptakkikkmkpeelleivgkgiekags
ssvidplaakiiarsgiktivigkedakdlfrvikgdhngttiep

Sequence, based on observed residues (ATOM records): (download)

>d2brxb2 c.73.1.3 (B:1-225) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekfns
setfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpghtt
davaallaeflkadllvvitnvdgvyakkikkmkpeelleivgksvidplaakiiarsgi
ktivigkedakdlfrvikgdhngttiep

SCOPe Domain Coordinates for d2brxb2:

Click to download the PDB-style file with coordinates for d2brxb2.
(The format of our PDB-style files is described here.)

Timeline for d2brxb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2brxb3