Lineage for d2brxa1 (2brx A:1-225)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905205Family c.73.1.3: PyrH-like [142721] (4 proteins)
    part of Pfam PF00696
  6. 2905225Protein Uridylate kinase PyrH [142728] (6 species)
  7. 2905242Species Pyrococcus furiosus [TaxId:2261] [142731] (1 PDB entry)
    Uniprot Q8U122 1-225
  8. 2905243Domain d2brxa1: 2brx A:1-225 [129028]
    Other proteins in same PDB: d2brxa2, d2brxb2, d2brxb3

Details for d2brxa1

PDB Entry: 2brx (more details), 2.4 Å

PDB Description: ump kinase from pyrococcus furiosus without ligands
PDB Compounds: (A:) uridylate kinase

SCOPe Domain Sequences for d2brxa1:

Sequence, based on SEQRES records: (download)

>d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]}
mrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekfns
setfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpghtt
davaallaeflkadllvvitnvdgvytadpkkdptakkikkmkpeelleivgkgiekags
ssvidplaakiiarsgiktivigkedakdlfrvikgdhngttiep

Sequence, based on observed residues (ATOM records): (download)

>d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]}
mrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekfns
setfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpghtt
davaallaeflkadllvvitnvdgvytadpkkdptakkikkmkpeelleivgksvidpla
akiiarsgiktivigkedakdlfrvikgdhngttiep

SCOPe Domain Coordinates for d2brxa1:

Click to download the PDB-style file with coordinates for d2brxa1.
(The format of our PDB-style files is described here.)

Timeline for d2brxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2brxa2