Lineage for d2brwb3 (2brw B:541-814)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309061Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1309200Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 1309343Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins)
    automatically mapped to Pfam PF02278
  6. 1309361Protein Hyaluronate lyase [50009] (2 species)
  7. 1309362Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [50010] (18 PDB entries)
    Uniprot Q54873 287-1007
  8. 1309380Domain d2brwb3: 2brw B:541-814 [129027]
    Other proteins in same PDB: d2brwa1, d2brwa2, d2brwb1, d2brwb2
    automated match to d1ojpa3
    complexed with so4

Details for d2brwb3

PDB Entry: 2brw (more details), 2.8 Å

PDB Description: crystal structure of streptococcus pneumoniae hyaluronate lyase from 30percent pegmme.
PDB Compounds: (B:) hyaluronate lyase

SCOPe Domain Sequences for d2brwb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2brwb3 b.30.5.2 (B:541-814) Hyaluronate lyase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgwytsdgmfylyngd
lshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtsklddanatatmdftnw
nqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpykvyvndkeaslte
qekdypetqsvflessdskknigyfffkkssismskalqkgawkdinegqsdkevenefl
tisqahkqngdsygymlipnvdratfnqmikele

SCOPe Domain Coordinates for d2brwb3:

Click to download the PDB-style file with coordinates for d2brwb3.
(The format of our PDB-style files is described here.)

Timeline for d2brwb3: