Lineage for d2brwb1 (2brw B:170-540)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 920404Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 920657Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 920669Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (4 proteins)
  6. 920687Protein Hyaluronate lyase [48237] (2 species)
  7. 920688Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [48238] (18 PDB entries)
    Uniprot Q54873 287-1007
  8. 920706Domain d2brwb1: 2brw B:170-540 [129025]
    Other proteins in same PDB: d2brwa2, d2brwa3, d2brwb2, d2brwb3
    automatically matched to d1f9ga1
    complexed with so4

Details for d2brwb1

PDB Entry: 2brw (more details), 2.8 Å

PDB Description: crystal structure of streptococcus pneumoniae hyaluronate lyase from 30percent pegmme.
PDB Compounds: (B:) hyaluronate lyase

SCOPe Domain Sequences for d2brwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2brwb1 a.102.3.2 (B:170-540) Hyaluronate lyase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
vkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekf
snyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivg
nwwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalggn
lvdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgayg
nvlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisrans
eghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsl
lsdagvasvpr

SCOPe Domain Coordinates for d2brwb1:

Click to download the PDB-style file with coordinates for d2brwb1.
(The format of our PDB-style files is described here.)

Timeline for d2brwb1: