Lineage for d2brwa3 (2brw A:541-814)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 795365Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 795492Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 795635Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins)
  6. 795653Protein Hyaluronate lyase [50009] (2 species)
  7. 795658Species Streptococcus pneumoniae [TaxId:1313] [50010] (18 PDB entries)
    Uniprot Q54873 287-1007
  8. 795675Domain d2brwa3: 2brw A:541-814 [129024]
    Other proteins in same PDB: d2brwa1, d2brwa2, d2brwb1, d2brwb2
    automatically matched to d1c82a3
    complexed with so4

Details for d2brwa3

PDB Entry: 2brw (more details), 2.8 Å

PDB Description: crystal structure of streptococcus pneumoniae hyaluronate lyase from 30percent pegmme.
PDB Compounds: (A:) hyaluronate lyase

SCOP Domain Sequences for d2brwa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2brwa3 b.30.5.2 (A:541-814) Hyaluronate lyase {Streptococcus pneumoniae [TaxId: 1313]}
tsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgwytsdgmfylyngd
lshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtsklddanatatmdftnw
nqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpykvyvndkeaslte
qekdypetqsvflessdskknigyfffkkssismskalqkgawkdinegqsdkevenefl
tisqahkqngdsygymlipnvdratfnqmikele

SCOP Domain Coordinates for d2brwa3:

Click to download the PDB-style file with coordinates for d2brwa3.
(The format of our PDB-style files is described here.)

Timeline for d2brwa3: