Lineage for d2brvx3 (2brv X:541-814)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391261Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2391489Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins)
    automatically mapped to Pfam PF02278
  6. 2391507Protein Hyaluronate lyase [50009] (2 species)
  7. 2391508Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [50010] (18 PDB entries)
    Uniprot Q54873 287-1007
  8. 2391527Domain d2brvx3: 2brv X:541-814 [129021]
    Other proteins in same PDB: d2brvx1, d2brvx2
    automatically matched to d1c82a3
    complexed with mla

Details for d2brvx3

PDB Entry: 2brv (more details), 3.3 Å

PDB Description: crystal structure of streptococcus pneumoniae hyaluronate lyase from 70percent saturated malonate.
PDB Compounds: (X:) hyaluronate lyase

SCOPe Domain Sequences for d2brvx3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2brvx3 b.30.5.2 (X:541-814) Hyaluronate lyase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgwytsdgmfylyngd
lshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtsklddanatatmdftnw
nqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpykvyvndkeaslte
qekdypetqsvflessdskknigyfffkkssismskalqkgawkdinegqsdkevenefl
tisqahkqngdsygymlipnvdratfnqmikele

SCOPe Domain Coordinates for d2brvx3:

Click to download the PDB-style file with coordinates for d2brvx3.
(The format of our PDB-style files is described here.)

Timeline for d2brvx3: