Lineage for d2brvx2 (2brv X:815-891)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777794Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 2777795Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (2 families) (S)
  5. 2777796Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 2777814Protein Hyaluronate lyase [49867] (2 species)
  7. 2777815Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [49868] (18 PDB entries)
    Uniprot Q54873 287-1007
  8. 2777834Domain d2brvx2: 2brv X:815-891 [129020]
    Other proteins in same PDB: d2brvx1, d2brvx3
    automatically matched to d1egua2
    complexed with mla

Details for d2brvx2

PDB Entry: 2brv (more details), 3.3 Å

PDB Description: crystal structure of streptococcus pneumoniae hyaluronate lyase from 70percent saturated malonate.
PDB Compounds: (X:) hyaluronate lyase

SCOPe Domain Sequences for d2brvx2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2brvx2 b.24.1.1 (X:815-891) Hyaluronate lyase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
ssliennetlqsvydakqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayyn
petqesapdqevfkkle

SCOPe Domain Coordinates for d2brvx2:

Click to download the PDB-style file with coordinates for d2brvx2.
(The format of our PDB-style files is described here.)

Timeline for d2brvx2: